Enterocin K1 (EntK1)

Enterocin K1 (EntK1)is a leaderless bacteriocin being particularly active against Enterococcus faecium, including nosocomial multidrug resistant isolates.

Name                           Enterocin K1

Class                             Leaderless three-peptide bacteriocin

Sequence                    MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC

Molecular Formula:  C₂₁₈H₃₂₁N₅₃O₅₁S₂                                       

Molecular Weight      4564.6 g/mol

Purity                             >95%
Producer Organism   synthetic
Expected target          Enterococcus faecium, Vancomycin-resistant Enterococcus                                                   faecium (VRE)

Other properties         Heat-stable, protease-sensitive. Stable for at least 1 year at                                                      room  temperature

References:

1. Ovchinnikov KV, Kristiansen PE, Straume D, Jensen MS, Aleksandrzak-Piekarczyk T, Nes IF, et al. The leaderless bacteriocin enterocin K1 is highly potent against Enterococcus faecium: a study on structure, target spectrum and receptor. Frontiers in microbiology. 2017;8:774.
2. Reinseth I, Tønnesen HH, Carlsen H, Diep DB. Exploring the therapeutic potenital of the leaderless enterocins K1 and EJ97 in the treatment of vancomycin-resistant enterococcal infection. Frontiers in Microbiology. 2021;12:649339.
3. Kristensen SS, Oftedal TF, Røhr ÅK, Eijsink VGH, Mathiesen G, Diep DB. The extracellular domain of site-2-metalloprotease RseP is important for sensitivity to bacteriocin EntK1. Journal of Biological Chemistry. 2022;298(11).
4.