Garvicin KS (garKS)

GarKS is a multipeptide bacteriocin composed of three small similar peptides with a size between 32 and 34 amino acids. Potent activity against many pathogenic Gram-positive bacteria (Listeria, Enterococcus, Bacillus, and Staphylococcus), representing a great potential for antimicrobial applications.

Name                          Garvicin KS

Class                             Leaderless three-peptide bacteriocin

Sequence      gakA:   MGAIIKAGAKIVGKGVLGGGASWLGWNVGEKIWK   

                         gakB:   MGAIIKAGAKIIGKGLLGGAAGGATYGGLKKIFG

                         gakC:   MGAIIKAGAKIVGKGALTGGGVWLAEKLFGGK

Molecular Formula:   C₁₆₁H₂₅₉N₄₃O₃₉S

                                        C₁₄₅H₂₄₇N₃₉O₃₇S

                                        C₁₄₃H₂₄₀N₃₈O₃₆S

Molecular Weight      3453.38 g/mol

                                        3161.08 g/mol

                                        3099.98 g/mol

Purity                             >95%
Producer Organism   synthetic
Expected target          Multidrug resistant Listeria, lactococci, streptococci,  bacilli,                                                   VRE, MRSA

Other properties         Heat-stable, protease-sensitive. Stable for at least 1 year at                                                      room  temperature

References:

1. Thapa RK, Winther-Larsen HC, Diep DB, Tønnesen HH. Preformulation studies on novel garvicin KS peptides for topical applications. European Journal of Pharmaceutical Sciences. 2020;151:105333.
2. Telke AA, Ovchinnikov KV, Vuoristo KS, Mathiesen G, Thorstensen T, Diep DB. Over 2000-fold increased production of the leaderless bacteriocin garvicin KS by increasing gene dose and optimization of culture conditions. Frontiers in Microbiology. 2019;10:389.
3. Ovchinnikov KV, Chi H, Mehmeti I, Holo H, Nes IF, Diep DB. Novel group of leaderless multipeptide bacteriocins from gram-positive bacteria. Applied and environmental microbiology. 2016;82(17):5216-24.